Skip to main content

NCBI, GENE BANK

 


GenBank Overview:


Learn how to navigate NCBI GenBank with the following video:



Activity 1: Retrieve the correct type of biological data from a given database.

Go to - https://www.ncbi.nlm.nih.gov/gene/60Search for “gene” “ACTB”. This is the human beta-actin gene. Click on the GenBank link that will take you to the sequence of this gene. Learn the annotations here. Start of the gene, end of the gene, mRNA, and CDS, and the difference between them. Also, have a look at the expression pattern.


Assignment: Generate a report that will include -


ACTB gene sequence, ACTB mRNA sequence, CDS sequence, and protein sequence. Please answer the following question in your report -

How would you explain similarities and differences observed within these sequences?

Repeat the same process for the human Insulin gene and include the same information for the human insulin gene in your report.


Activity 2: Characterizing Data

In this activity, you will characterize the genomic data from NCBI GenBank. Go to https://www.ncbi.nlm.nih.gov/genbank/Search for nucleotide sequences related to “human JUN”. Click on the very first hit which would read “Human c-jun proto-oncogene (JUN), complete cds, clone hCJ-1”. Note down the GenBank accession number.


Assignment: Answer the following questions in your report:


What chromosome is this gene located on?

How long is this gene?

Who has submitted this sequence to Genbank and when? In which year was their research published?

What cell type in humans did the researcher use to extract this gene sequence?

What is the coding sequence and protein sequence of this gene? How long is the protein and what is the GenBank accession number for the protein sequence?


Repeat the same process and create individual gene reports using the keywords:

Human MTR, human AKT3 and human NGF.


Activity 3: Sorting the given biological data to solve a biological question

Assignment: Find the DNA sequence for the human beta hemoglobin gene and answer the following questions:


What chromosome is this gene located on?

Would this gene make a protein?

In which tissues is this gene expressed?

What are some diseases/conditions associated with this gene?


Include your answers in the report you will submit at the end of this activity. The report is a project that you will work on:


Two different sequences are listed below. For each sequence, determine whether it is a DNA, RNA, or protein sequence and state whether they are the products of the human beta hemoglobin gene. To make that determination, you will need to remember the lesson/activity:


Sequence 1

AAUCACUGCUGUGCAGGGCAGGAAAGCUCCAUGCACAUAGCCCAGCAAAGAGCAACACAGAGCUGAAAGGAAGACUCAGAGGAGAGAGAUAAGUAAGGAAAGUAGUGAUGGCUCUCAUCCCAGACUUGGCCAUGGAAACC

Sequence 2 MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE

Comments

Popular posts from this blog

Genetic Mutations

  GENETIC MUTATIONS Genetic mutations  are spontaneous changes occurring in the genetic material, (DNA) of an individual. Mutations can be passed to the next generations or may not, depending upon the type of cell in which they occur.       They can be harmful, beneficial or even neutral. Usually these are caused naturally but they can be caused by harmful radiations or chemicals or drugs etc. Somatic cell’s mutations do not pass to the offspring. While the mutations in germ line cells are hereditary. The term mutation was given by Devries in 1909. Types of Mutations Two most basic categories of mutations are: Point mutations These mutations are those occurring only at certain points in chromosomes or the genes if it. For example, insertion, deletion etc. Chromosomal mutation More sever class of mutations is chromosomal mutations. It includes deletion of one or set of chromosome, or may be more number of chromosomes is present in genome than normal numbers....
 Genomics_command_line_quiz1 For all projects, you may use your own Unix-based system and, where applicable, ensure that you are running the version of the software specified in the assignments. Alternatively, you may use the VMBox virtual machine environment provided with the course materials. Instructions on how to download and use the environment can be found on the course web site. For the following questions, refer to the class workflow and use the data in the Online materials (‘gencommand_proj1_data.tar.gz’) to answer the questions. Assume you sequenced and assembled the genome of Malus domestica (apple), and performed gene annotation. You then collected samples and ran RNA-seq experiments to determine sets of genes that are expressed in the various tissues. This information was stored, respectively, in the following files: “apple.genome”, “apple.genes”, “apple.condition{A,B,C}”. NOTE: The apple genome and the apple gene annotations for this project were extracted from the Ro...

Databases for Biological Data

Databases for Biological Data Now that we understand the building blocks of biological data, let us take a look at the various online databases to store them: GenBank :  The GenBank  sequence database  is an  open-access , annotated collection of all publicly available  nucleotide  sequences and their  protein  translations. It is produced and maintained by the  National Center for Biotechnology Information  (NCBI; a part of the  National Institutes of Health  in the  United States ) as part of the  International Nucleotide Sequence Database Collaboration  (INSDC). GenBank and its collaborators receive sequences produced in laboratories throughout the world from more than 100,000 distinct  organisms . The database was started in 1982 by  Walter Goad  and  Los Alamos National Laboratory . GenBank has become an important database for research in biological fields and has grown in recent years at...